PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0116s0047.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 382aa    MW: 43761.2 Da    PI: 9.3479
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0116s0047.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B338.12.7e-128583587
                         EEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                   B3 35 tltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87
                         t  l  +sg++W v++  +  ++   +t+GW++Fv++n +++g+f+ Fkl g+
  Kalax.0116s0047.2.p  8 TAELAGRSGQTWLVEV--DYDGKDLCFTDGWQDFVEDNMVQDGEFLFFKLLGN 58
                         678999**********..778888*************************9886 PP

2B356.93.8e-18130221196
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          f+k  t s+    + l++p  fa+eh+++ +++ +++l+++++ sW+v++   +++g++ l +GW  F+++n+L+ gD++ F+l+gr   
  Kalax.0116s0047.2.p 130 FEKHITISNIEHGHYLRIPSYFAQEHSLNYKSNEKMVLRTSRNSSWKVNI--INRGGEISLCRGWAAFARENNLRLGDVCNFELVGR--L 215
                          677777777777899***********88888999****************..999999*************************9984..5 PP

                          ..EEEE CS
                   B3  91 elvvkv 96 
                          e++v+v
  Kalax.0116s0047.2.p 216 EMLVHV 221
                          556665 PP

3B353.44.7e-17281376296
                          EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE..EEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                   B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr..yvltkGWkeFvkangLkegDfvvFkldgrse 89 
                          +  +++++v ks+ l +p  f++e+++  e++ +++l++e+   W + +i++k+ ++  + l++GW +Fv++n++kegD++ F+l++r e
  Kalax.0116s0047.2.p 281 VALMKKHHVEKSA-LNIPAWFFRENSLHYERNEKMVLRSEKDSLWLLSIIHSKYNNKtlCRLSGGWIDFVRDNNIKEGDTCKFELVNRLE 369
                          4455556666665.***********99999999****************99777777679999*********************997644 PP

                          E..EEEE CS
                   B3  90 felvvkv 96 
                           +++++ 
  Kalax.0116s0047.2.p 370 MKFHIMP 376
                          4344444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.774169IPR003340B3 DNA binding domain
CDDcd100177.27E-10167No hitNo description
SMARTSM010190.14169IPR003340B3 DNA binding domain
PfamPF023628.4E-10658IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.8E-13771IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.28E-13871IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.4E-22127223IPR015300DNA-binding pseudobarrel domain
CDDcd100171.26E-16128221No hitNo description
SuperFamilySSF1019365.3E-20128222IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.944130225IPR003340B3 DNA binding domain
PfamPF023621.4E-15130221IPR003340B3 DNA binding domain
SMARTSM010193.1E-12130227IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.5E-20274376IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-19274376IPR015300DNA-binding pseudobarrel domain
CDDcd100175.80E-17278374No hitNo description
PROSITE profilePS5086312.323279378IPR003340B3 DNA binding domain
PfamPF023621.6E-14280376IPR003340B3 DNA binding domain
SMARTSM010191.6E-16280378IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MDERKFGTAE LAGRSGQTWL VEVDYDGKDL CFTDGWQDFV EDNMVQDGEF LFFKLLGNLM  60
FSFIIYDETM CEKEAAFNGK CSRGREAVEE PMGLKPVKRR NMGCSQPEGS LFTSKDKTAV  120
KTSISVKPTF EKHITISNIE HGHYLRIPSY FAQEHSLNYK SNEKMVLRTS RNSSWKVNII  180
NRGGEISLCR GWAAFARENN LRLGDVCNFE LVGRLEMLVH VAHQDKVIEE KQLNVAAPKI  240
RPSERAVGVS QPKLRQGLPI IAERHKAAGR SRPSPGKPSF VALMKKHHVE KSALNIPAWF  300
FRENSLHYER NEKMVLRSEK DSLWLLSIIH SKYNNKTLCR LSGGWIDFVR DNNIKEGDTC  360
KFELVNRLEM KFHIMPRSKQ D*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19399LKPVKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.13e-17B3 family protein